dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0081356 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:complement(4088084..4088395,4088475..4089693,4089751..4089995,4090057..4090092); ID=FBpp0081356; name=RpA-70-PA; parent=FBgn0010173,FBtr0081867; dbxref=FlyBase:FBpp0081356,FlyBase_Annotation_IDs:CG9633-PA,GB_protein:AAF54206.1,REFSEQ:NP_524274,GB_protein:AAF54206,FlyMine:FBpp0081356,modMine:FBpp0081356; MD5=4425d39514b971d001063620ad1e6d81; length=603; release=r5.30; species=Dmel;
Sequence length 603
Sequence
MVLASLSTGVIARIMHGEVVDAPVLQILAIKKINSAADSERYRILISDGKYFNSYAMLAS
QLNVMQHNGELEEFTIVQLDKYVTSLVGKDGAGKRVLIISELTVVNPGAEVKSKIGEPVT
YENAAKQDLAPKPAVTSNSKPIAKKEPSHNNNNNIVMNSSINSGMTHPISSLSPYQNKWV
IKARVTSKSGIRTWSNARGEGKLFSMDLMDESGEIRATAFKEQCDKFYDLIQVDSVYYIS
KCQLKPANKQYSSLNNAYEMTFSGETVVQLCEDTDDDPIPEIKYNLVPISDVSGMENKAA
VDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWGDDAVNFDGHVQPVI
LVKGTRINEFNGGKSLSLGGGSIMKINPDIPEAHKLRGWFDNGGGDSVANMVSARTGGGS
FSTEWMTLKDARARNLGSGDKPDYFQCKAVVHIVKQENAFYRACPQSDCNKKVVDEGNDQ
FRCEKCNALFPNFKYRLLINMSIGDWTSNRWVSSFNEVGEQLLGHTSQEVGEALENDPAK
AEQIFSALNFTSHIFKLRCKNEVYGDMTRNKLTVQSVAPINHKEYNKHLLKELQELTGIG
SSN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]