dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0081398 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:join(4577804..4578120,4578236..4578840,4578903..4579180,4579243..4579521); ID=FBpp0081398; name=CG8223-PA; parent=FBgn0037624,FBtr0081915; dbxref=FlyBase:FBpp0081398,FlyBase_Annotation_IDs:CG8223-PA,GB_protein:AAG22135.1,REFSEQ:NP_649828,GB_protein:AAG22135,FlyMine:FBpp0081398,modMine:FBpp0081398; MD5=4aa1b2addc0c4bf3e6dba7b134520875; length=492; release=r5.30; species=Dmel;
Sequence length 492
Sequence
MSAEAEAIVTTATADVSSPSKTVAVEPVAADTTPDNAPAVSTEGSGKAEQERAEKILKGK
ELFSQGSRNFLVKSYDEAADELSQVCQLYEEVYGELADELGQPLLLYAKALIAMALDENK
VIDVPDEAADDDDEDVDDDEEESAEDGAAKKEEKKDTKEAANGASSSNGKELDTIKEGSD
EADSTGEAEQAQSDEKPSKKVPTGVDEVSSSNGGGGAAVNDDERPSTSNGEVTASCSNGA
APAVEEEPEEEEGVSGSLQLAWEILEAAAQIFSRQGLSGLPYLAEVQTELANIEFENGIL
EAAREDYEKALKIHGELPTRNRRALAELHYKIGLTYLMQQLNKEGATALRQSSVLIEEEI
AEIKGKDEPSERDRNNMLDLEETKQEILAKIQEIEEMQAQTIAEVRAALDSYIKPMSSGD
AAAASSSSSSSANGAASSSSSSSKGAAAASSSTISSSSAKPTDITHLIKRKKPEDPSSEA
EALCSPAKRAAV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]