dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0082591 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:complement(11048122..11048172,11048230..11048367,11048425..11048745,11048803..11048814); ID=FBpp0082591; name=Rpb7-PA; parent=FBgn0051155,FBtr0083137; dbxref=FlyBase:FBpp0082591,FlyBase_Annotation_IDs:CG31155-PA,GB_protein:AAF55145.2,REFSEQ:NP_731983,GB_protein:AAF55145,FlyMine:FBpp0082591,modMine:FBpp0082591; MD5=2b1341016a2bde0a57668d7ba0e1b302; length=173; release=r5.30; species=Dmel;
Sequence length 173
Sequence
MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFC
PNGNPPCYKSKDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]