dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0083680 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:complement(18356463..18356529,18356593..18356735,18356793..18357398,18357453..18357605); ID=FBpp0083680; name=CG33093-PA; parent=FBgn0053093,FBtr0084287; dbxref=FlyBase_Annotation_IDs:CG33093-PA,FlyBase:FBpp0083680,GB_protein:AAO41589.1,GB_protein:AAO41589.2,REFSEQ:NP_788715,GB_protein:AAO41589,FlyMine:FBpp0083680,modMine:FBpp0083680; MD5=c751fed770ba49d43ca392b0bb9820cd; length=322; release=r5.30; species=Dmel;
Sequence length 322
Sequence
MKSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFD
GFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQL
PGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYP
PVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGE
TMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSD
VIQNAYDITMALAKGAFAHHYS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]