dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0084076 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:join(20633408..20633805,20633864..20633986,20634059..20634290); ID=FBpp0084076; name=CG6980-PA; parent=FBgn0039228,FBtr0084698; dbxref=FlyBase:FBpp0084076,FlyBase_Annotation_IDs:CG6980-PA,GB_protein:AAF56341.1,REFSEQ:NP_651289,GB_protein:AAF56341,FlyMine:FBpp0084076,modMine:FBpp0084076; MD5=e352b02e243b6b3dfde6c925bb64e832; length=250; release=r5.30; species=Dmel;
Sequence length 250
Sequence
MANEEVKDNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDA
KEKINFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEA
RAKAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKR
ALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQ
LEADLKALEI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]