dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0084162 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:complement(20890369..20890518,20890583..20890716,20890870..20891136,20891200..20891236); ID=FBpp0084162; name=veli-PA; parent=FBgn0039269,FBtr0084787; dbxref=FlyBase:FBpp0084162,FlyBase_Annotation_IDs:CG7662-PA,GB_protein:AAF56389.1,REFSEQ:NP_651330,GB_protein:AAF56389,FlyMine:FBpp0084162,modMine:FBpp0084162; MD5=299e56e94f23de42266eafefcb7dcb77; length=195; release=r5.30; species=Dmel;
Sequence length 195
Sequence
MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]