dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0085184 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:join(27496501..27497517,27497636..27497802,27497866..27497947,27499179..27499359,27499428..27501103,27501180..27501422); ID=FBpp0085184; name=CG1815-PB; parent=FBgn0039863,FBtr0085823; dbxref=FlyBase:FBpp0085184,FlyBase_Annotation_IDs:CG1815-PB,GB_protein:AAN14281.1,REFSEQ:NP_733442,GB_protein:AAN14281,FlyMine:FBpp0085184,modMine:FBpp0085184; MD5=c5cc261ee5e3ec92ab1bc707a7bebf8b; length=1121; release=r5.30; species=Dmel;
Sequence length 1121
Sequence
MESTDSSDSSGDSLKSIPRPDFEALSAIGSPQPQLQSSSLDGHVEMEPVIMPSKRQKYIV
SAPPGSANCSSNSSSSSPSNINVGSSLTMKLTKVQPQQHQAKSSTPNNKGKVAKEMVALQ
RSHIESEVLSNFVTGVSKLKSRKSRYVPGNLATQAVGGELSRSLNTSSENENKSLKVALK
RSSSIPAPILDSDDDWQDEDIAWGVTTCRPRGRSMAFEDGERLANLNAEDRNIVPAYSMA
TRCRSRSKTLSLSNSWSNDDKGPRRSNLRSENEEFAKKHNAFLDRIIHDDRESELALNTS
GEGESSLFSDASDTKTTTAKTPEEEAAERLALIYEEPPTPGWDPFCWKCRGCGKLMPCSK
CLRSFHSYCVRPATTKFDSSWKCPECQVIEAAPKRLRRNGVSVDLLSQLLSFALDRMKHV
RGAHKLRSPLEVFPLTYKKFFVNPVSFESLAQCIRNGAYQSTDEFLSEVKWIQHNALILD
AGDAKVEQASKAVVKVCRQEANEIDTCPECYLNANSSDEWFVKVCRHPHLLLWAKLKGFP
YWPAKAMGSSNSTLVNVRFFGKHDRAFVPVKDCFLYSAQNPNTQTSRRSARDLAECIREV
EIHIDHIKRKIGAFNYAPYRTPYDPLEEQQQLEQMMPGVYAAIDRELEPANKTPLQFLIR
KTADDKLSIVKKTKATESGNESDQSPSPTKKLSEVDVVSVTGSGCSDHSNVKSNNYEVIS
RSGESLTDSRCKVLLKRKSLAAKIVAESVETSEAVAPKRKHSLSDASFTSESSEHKRKSK
HARKQHDNQDNQIEEAEKTGQEPPKSPTISKQNENLRDEENVIENAANDTSSASPVSASV
VSVVELVRRRQGVTITKIPREQQQTAEDTAAVPIPLPTAPPPKQNIPKGNEAANPKQSDV
ERQQEQLIKKVIPFIEIKTEVMSEPDDEGIEEASPANQPQTDQVPLQQETITAQPESQMP
AAAPAPQPKPVDNAPFEEVRIKEEILSEDEMETEQSIVSRRLKSVPPMPLPMPPPPPLPP
REESPATADSVRFVGDTTIQRVYPRHPLQLTRPFCQPHLHLRHHQSQLARLLLASHRLRH
RPRESLRHTFNFEEKTIVSQPPHRRLLHQPQTRLLCSDPTW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]