dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0085344 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(2097599..2097731,2097792..2097988,2098052..2098165,2098233..2098360,2099101..2099649,2099724..2100663,2100721..2100832,2100974..2101256,2101317..2101446); ID=FBpp0085344; name=l(2)k14710-PA; parent=FBgn0021847,FBtr0086000; dbxref=FlyBase:FBpp0085344,FlyBase_Annotation_IDs:CG8325-PA,GB_protein:AAF57269.1,REFSEQ:NP_652063,GB_protein:AAF57269,FlyMine:FBpp0085344,modMine:FBpp0085344; MD5=2ea7e37329902b3250aeda53ef17ea57; length=861; release=r5.30; species=Dmel;
Sequence length 861
Sequence
MANKNMRNTTTKVEALIESCRSEGKWHRVIELTDELKTGSPHNECLANFLVGEARLESYL
EENALASDSNFGRAKSGLAEARRFLHLALGESGQKAGIALDAYLLLAKLCFACGEYEQSL
DNFVKAELNTLAEKELTLRSLKILAESYAIKGLCLEQQTTKPSSKFKKAEKDTEMISCFE
RASDLGLLYLQEYDLVSGSSGSSNNSTAGSTLNVNASTVQPSSSSFAISSTIPASGPSGL
EMNRRMGAILETALQRAPIVLIKTEKLQEAVERYRIMLNAIETRATQSLRLTLARQLAEV
LLRGVSGTIYSPPFTGKSGGGTLRGGSSKKLWKPRKYAARQQFNPRNQQEEVILLLLIAE
ALAVRDTVLSQSPEFRQARQHAMGNVTAVYDLLTLATVRWGLVQLLNESFEKALKFSFGE
QHVWRQYGLSLMAAEKHSHALRVLQESMKLTPSDPLPCLLASRLCYESLETVKQGLDYAQ
QALKREVKGLRPSRSQLFVGIGHQQLAIQSNLKSERDACHKLALDALERAVQFDGNDHLA
EYYLSLQYALLGQLAEALVHIRFALALRMEHAPCLHLFALLLTSSRRPREALGVVEDALH
EFPDNLQLLHVKAHLQLHLEDAETALGTVQHMLAVWRDVYEAQLAGEEEKHSDTKSGVHL
AHSSQMSDKDSNSVYAASLAAVSRVEQALSEAASSLSSFTQRPGPRRPWMLQIEIWLLLA
DVYLRIDQPNEALNCIHEASQIYPLSHQIMFMRGQVHVYLEQWFDAKQCFLNAVAANPNH
TEALRALGEAHLVLGEPRLAEKMLKDAAKLDPSCPKIWFALGKVMEILGDFHASADCFAT
SLQLEPSCPVLPFTSIPLVFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]