dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0085676 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(15573191..15573492,15573573..15573718,15573780..15574063,15574151..15574327,15574394..15574786,15574877..15575043,15575114..15575387); ID=FBpp0085676; name=CG15128-PA; parent=FBgn0034467,FBtr0086481; dbxref=FlyBase:FBpp0085676,FlyBase_Annotation_IDs:CG15128-PA,GB_protein:AAF57524.1,REFSEQ:NP_611441,GB_protein:AAF57524,FlyMine:FBpp0085676,modMine:FBpp0085676; MD5=3cec6af5c4661c3badaa546432e9e892; length=580; release=r5.30; species=Dmel;
Sequence length 580
Sequence
MTSIVEMPRANLEEALPPWMKIDWSDEVLHDIYRDWGTYYSRRRRENFALHYLNKALALE
PTDHMTLYKRCQSKRKAAQMLGALDDSRAAAKLARSKDGEEKAIINLDICDVLYELNQFE
NSKAEMHNNMRVFIGNKRKSFEQRQLVVDGVIKDVTGEAMSAFFTKNLKTVSIVHDLIKE
RERVDNRPLWKRLKEQGKCDVQSIPEVPEEMLSPMEIARRKRAFNIFHQSYINDSWIDVL
FMKMLCKNPNLLLPQCKESSYFLQQLSSKQYEIVRKFMKMLQSRSPLYLVNYLKYGNKAM
SDKYREAYLFRVQYQTHRNMNHALKEIRALRKAKKVQQLAKFVEELMGTYVVLKTARVMC
WKFEFLNEVYNTMALTLAEQLRVPKGFTPYGSNAILKLLRLPVERVKDFVPVTFGDRAPE
PEGNDPATTRAKRLTARLEHRMVFAKYSIEKCYLLHQISQSYLDQGRHSECTYNARKAIK
ESKNCNSNLWKFLSVVQIVKANAILHKLEQTKEALEDALPIAHFLKSSELILFIENCMAC
NTEDSINKRATLMQARRVSKSESVATHSLVSGQDVDSQGG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]