dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0089396 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=X:complement(5213169..5213615,5213687..5213789,5213846..5213966,5214031..5214537,5214592..5215536,5215595..5215770,5215852..5216360,5216423..5216440); ID=FBpp0089396; name=Rnp4F-PB; parent=FBgn0014024,FBtr0070753; dbxref=FlyBase:FBpp0089396,FlyBase_Annotation_IDs:CG3312-PB,GB_protein:AAS65263.1,REFSEQ:NP_996353,GB_protein:AAS65263; MD5=45b62dc90f526d0fb886ec9edfa405b0; length=941; release=r5.30; species=Dmel;
Sequence length 941
Sequence
MDADKQLERQLEKELDEMPAEDLDDDAYDEYDLIVIPDQGKGSPQQGHSESPQQEEEHKS
EELRQRSRPTWPPSSAGGDMTTIELISSDDEPSVEETEGGNAAGRGRARNDSSSSSDDVG
VIEGSELESNSEVSSDSDSDSDNAGGGNQLERSYQELNALPSKKFAQMVSLIGIAFKLND
LEKIESSVLELQNLATVPAHVWLKYLKARLVVTQTDEERKAFEEQCAKALGYYYSIPLSE
YVVNYLVDQGNVQNHVLWAKLLADYDVERPDFGDKLRSLISTITDENEAAAFVEMLQKHC
VTWTCNVEQRQMIKSVVDKFKQHLDETTRGWDWSEQHKAHVYDVETLSLDDDLKNAVIRF
IFERSVAKFPIVDVLWLSYIEFIQFEGVTVPENEDENEVTAEMVAKRAKRLGKGFLRNTE
LDLANRGVRSHPSVQLNHRFLDLMERSDFELAEVDEEIRLILQRIVTDMDMTVELHLDYL
AYRIRNTNASDEQQVASLRAAFNHAWEELTVLYGDQADTRYEVLQLWAQVEYTQLGSPDN
GREIWRQIMGYPGSSIRGLLWLNFAQMESEYNGGHGTRDVLRKALSQPVLENGLMVQEFF
RRYERCYGTYESIAACQALDLPVEYVKPRSRIKPNSQSAYPRQQKLKPRQQQQQTNREPL
NREQRRRQAHEQQQQQQQQQKHGIKKSRTEPSGGATSPPSKVKGPANAEAKESNFKYSPN
MEINKIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRA
VAGRDGCLFKGMNISVAISNPPPRGTSAVKPSVAPKRRVPTSLIPTTLVRQEVAAKKLRL
LLPEPGDISSTSASVDVAIKREANGEEQKGDVQERDEQKGEEQKGEEQKGEEPKGEEQKG
DDQIGEEQSGVEQKGDEKKEEEMPAAVPKSNDDFRKLFLKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]