dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0289271 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(5054368..5054824,5054883..5054968); ID=FBpp0289271; name=CG42382-PA; parent=FBgn0259728,FBtr0299994; dbxref=FlyBase:FBpp0289271,FlyBase:FBpp0087700,FlyBase_Annotation_IDs:CG8016-PA,FlyBase_Annotation_IDs:CG42382-PA,REFSEQ:NP_523665,GB_protein:AAF58972,FlyMine:FBpp0289271,modMine:FBpp0289271; MD5=3332b929fedd8ab3ca079c25357c7c8e; length=180; release=r5.30; species=Dmel;
Sequence length 180
Sequence
MSLVADYSDSSESDEDSSGQFSEDGETKSAAPAKNEKTPPPKLPSASQAFSQGAGKGDVF
NNPFLEAELHKTASLERHVKMVDNDAHQKLKNGRKICWNFRRGRCRFGTSCQYAHDSDLS
VDEAAEKSALPDQSVPVVVEAAPGNFNRRKRPGLGDALEPGKRVMKSYKQQNPQNPFARR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]