dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0289361 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(3370899..3371069,3371152..3371304,3371367..3373320,3373390..3373610); ID=FBpp0289361; name=wech-PE; parent=FBgn0259745,FBtr0300084; dbxref=FlyBase:FBpp0289361,FlyBase_Annotation_IDs:CG42396-PE,REFSEQ:NP_001137615,GB_protein:ACL83069; MD5=12054328bfeaaa398213d13a5976da9e; length=832; release=r5.30; species=Dmel;
Sequence length 832
Sequence
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERLLAGILESFPA
WDLNVGLLPNVGQSSPPRADFFINNFLGGLDTHGDFSIGPIGSGARSNPKMSPESSNNSS
ISCGWCEVSASIRCLECNEFMCNDCLREHRNSPLSSNHSIVSLPTPIGASPTGGSSVNAQ
TPPSGNFICDIHNEMLRYVCDYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIE
SSQVGTRCIKSSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLR
QRRLAILHDQMAGLKSALAGLSETSDMLSKVADNACNMDQIEIAMKLTNGQRQMEQFAGI
YKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPIVSSSNGIVPSVSSVNAVAAA
SVGVVGGVAGVVGGVGVSNGLDLAFGMNMPNNPLSVASSSVRRPLLRDNSFRIPSPIMQP
RGGSACGMSSGMSSAALDWELNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSF
ATEGHEDGQVSRPWGLCVDKMGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLP
AGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKEYGQFQYPWDVAVNSRRQIVV
TDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCYTPTGNIIVSDFDNHCLYLID
PDINDILSVKGHEGSGFHEFNRPSGLCCDDEGRIIVADSKNQRILVFNQNLDFMWDIEVR
PSINPLMPPTLDEKDRTCDVAIMPDGRIVFLIELSPDSKEGSNPYKRFVHVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]