dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0291097 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(15318611..15319067,15319132..15319242,15319297..15319751,15319808..15319897,15321007..15321146,15321208..15321347,15321409..15321613,15321669..15321813,15321875..15322007,15322065..15322197,15322260..15322755,15322819..15323054,15323113..15323222,15323282..15323984,15324053..15324101); ID=FBpp0291097; name=Fak56D-PG; parent=FBgn0020440,FBtr0301883; dbxref=FlyBase:FBpp0291097,REFSEQ:NP_001137719,GB_protein:ACL83173,FlyBase_Annotation_IDs:CG10023-PG; MD5=19e815ed52834f904f330652e9b8e2c2; length=1200; release=r5.30; species=Dmel;
Sequence length 1200
Sequence
MNTAGATSQPPPTKNEINSEEYLIHVHMPNKSFKAVRFNVKETVFHVIRRTVEDLGTDGR
TPSIQRYACRMLNMITKEVIWLARSTSMQKVLSHILTPGCSNVDCPNNQSELDEVLLEHG
RRITDNRVWRVELRVRYVPNNIQELFEEDKATCFYYFNQVKEDFIQANVTAIDTEVAVQL
CCLGIRHYFKNITVKAPDKKQHIDYIEKEIGFKSFLPQSVIATSKPKNLKKLIQVGYKKV
YNYNDIEYLTRFFDLLKNIYLTNFEQFSVTLSSAWNISGILHVGPHIGISYQTHPQASLK
NVAQFKDVVSIKTCTLPKEKLSKSGENTTEPELQNFNCNCQKIKTQIKISASNNVEDLVI
TCNGINTAESIADLIDGYCRLLSKDLEFTIWHRETNASNEDSAKALPNDATLGSNKSTSS
QGKPMLTDDYAEIGLLEGEGDYSTPTVRNYELDRALITPSAKIGVGQFGDVYVGTYTLPK
LGKGKNLAGNGKNSNSDQRNADSRPDVIQVAIKTCKANDDPEKTENFLAEAYIMQKFDHP
HIIRLIGICSVMPIWIVMELAKLGELRAYLKTNSERLSHGTLLKYCYQLSTALSYLESKK
FVHRDIAARNVLVSSPTCVKLADFGLSRWVSDQSYYHSTPTVALPIKWMSPESINFRRFT
TASDVWMFGVCIWEILMLGVKPFQGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQCWA
YEPLKRPNFKRIKETLHEILIEDSINSSETLKREQRKVASMSWIGSDDIDIPPSKPSRVM
HDPDITGLMPETTGLPQTYIIAQNPAVLAKLMMENQKRGINPAAYTTPASGIHNVLGEKL
RQQQKDSNSDSEWLIQEELLRQRSCSIPQGSLNDHQAQMFKLDFMSAGPSSLPDCSNSSS
RPMTPNANLSSLKSNHSSADHLSSLTSAEEQMGSNARNLGSAVPSRPPNRADDEVYCATT
LVVKSIMALSQGVEKANTEGYLELVKNVGVKLRNLLTSVDKISIIFPAQALKEVQMAHQV
LSKDMHELVSAMRLAQQYSDTTLDCEYRKSMLSAAHVLAMDAKNLFDVVDSIRQRYQHLF
PPSATKETSCSSSFESTSGSIVAEPVNDLGGYIKTSTSGDLLQNTGIYDNDLHHSFNSQL
QLQNPKASIDLSGGGSLQRGMSLGLDTTRSTNEPLRIVEETLGSPGEHMYCNTSALHGHA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]