dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|15806901|ref|NP_295624.1| (Deinococcus radiodurans R1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein DR_1901 [Deinococcus radiodurans R1]
Sequence length 162
Sequence
MFNTRKSALVIAALLSLGAPALAGTSSTQTDYDNATLSLSADGTYAQAVSFSVPSTTVTL
SAEQIRPGNSFTLSIPVTNTTDRDINVSAVAQAPSGTGAAHLKVSGVSTTATIKPGEDAT
LTFTLTFDNSTDAAQAGQTVQVVFDVSATANMNNTSSSGSSF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]