dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0231719 (Drosophila virilis 1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_12963:join(10079227..10079251,10080563..10081313,10081374..10081902,10081963..10082241); ID=FBpp0231719; name=Dvir\GJ17302-PA; parent=FBgn0204475,FBtr0233227; dbxref=FlyBase:FBpp0231719,FlyBase_Annotation_IDs:GJ17302-PA,GB_protein:EDW64143,REFSEQ:XP_002051988,FlyMine:FBpp0231719; MD5=9735356a813772bc3c41b15574bfe224; length=527; release=r1.2; species=Dvir;
Sequence length 527
Sequence
MSSHATSIDNANEPERAAGAGGNHSRHRRSSSSAVCMHDARFYRNPNRPVHKIWTNSECA
KYFLCLDGEVFEFKCSEGLLFDVVRQICDFKANVDNCDISAETPAPKPLLEMADCADETQ
LGCADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCQLPHCFCSKDGTQ
IPGNLQAQTVPQMILLTFDDAVNHDNWELFSKVLFTANRRNPNGCPIRSTFYVSHPYTNY
QYVQKLWNDGHEIAVHSVTHRGPELWWSKNATIEDWFDEMVGQANIINKFASVRMEELRG
MRVPFLRVGWNRQFLMMKEFGFVYDASMVAPHSNPPLWPYTLDFKMPHSCLGANQNCPTR
SYPGIWEIVMNQLEAGAGEYTCGMVDSCPPHLTGEDVYRMLTYNFKRHYLSNRAPFGLYF
HSTWFKKIDYLNAFLKFLDDMQKLPDVYFVTNQQAIQWMRKPTPSNQLHQFEPWHCQPKQ
LEPHEQVCQMPNVCKVRSRVLQEDRYFYTCMECPAQYPWIRNEFGLE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]