dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0219199 (Drosophila simulans 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:join(16090475..16090604,16090668..16090823,16090890..16090951,16091008..16091408,16091464..16091737); ID=FBpp0219199; name=Dsim\GD20797-PA; parent=FBgn0192260,FBtr0220707; dbxref=FlyBase:FBpp0219199,FlyBase_Annotation_IDs:GD20797-PA,GB_protein:EDX13630,REFSEQ:XP_002104127,FlyMine:FBpp0219199; MD5=5d1321466cfd6b8d7c807f59ad711318; length=340; release=r1.3; species=Dsim;
Sequence length 340
Sequence
MMKRQNVRTLSLVVCTFTYLLIGAAVFDSLESPTEAKRWDFLQTVKNNFVRKYNVTDEDF
RVMEIVIIENKPHKAGPQWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFCMGYAMVGIP
LGLVMFQSIGERLNKFASVIIRRAKRASGARCTDATEMNLMLATGMLSSIIITTGAAVFS
RYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSLVFILFGLAVVAASI
NLLVLRFMTMQAEDAKRDEQDAQNLAGNAQPVTFDDESTYNTHGKLLENNYTTENDETAS
LCSCTCMGGTRCLNHEQFVDPDFQPTDIIESTLCLKRASV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]