dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0271423 (Drosophila yakuba 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:join(15493109..15493221,15493287..15493722,15493896..15494144,15494230..15494489,15494562..15494706,15494771..15494920,15494984..15495161,15495219..15497812); ID=FBpp0271423; name=Dyak\GE26413-PA; parent=FBgn0243438,FBtr0272931; dbxref=FlyBase:FBpp0271423,FlyBase_Annotation_IDs:GE26413-PA,GB_protein:EDW97515,REFSEQ:XP_002097803,FlyMine:FBpp0271423; MD5=cdfabd3f873a101219ed452d417f1ab7; length=1374; release=r1.3; species=Dyak;
Sequence length 1374
Sequence
MTQSAGWLPACEDWSKHEELSYGWERAIDSKGRSYYINHLNKTTTYEAPECIRWDEHPPE
PRQVQLQRNASLGFGFVAGSERPVIVRFVTEGGPSIGKLQPGDQILAVNGEDVKDAPRDH
VIQLVRACEAQVNLLVCQPMAHCVLPGRKSTLLSAGKRAKLRSRPSRVRFAESVCVNGAP
LFPPSAFSLGDICVPPMANVLKVFLENGQTKSFKYDATTTVQDVVSSLLDKLCLCCGELF
SLVLEHVKSLKRNKLTLLDPQESLARIAARPGAHKLRCLFRITFVPISAAELAQRDLHAL
DYLYLQCCNDVNQERFAPELQPELALRLAALHMHQHALANNFAPAKLTVKLVEREFGLER
FVPVSLFEGMKRKELRRLISHFLKLNAEMTGSSSKVLTQLQAKLHYLDIIASLPSYGAKC
FSTNQREGVERVLLVSPRFGLSQISSARNSVPQPISAIEDFTHVVVNREDDVTCSVSIFM
LGDRAVKFIMEDRDGCEFSLVLGGYYRLLTGNVLNILREREPNDEDNAPGFLSQHTVLPA
GWSYLLPFHTRAHSVNFLMAPPYHPLVQRGQLQQQSSIQAPTSLPYVMDLDLHSVMATEL
LEEAAKDSGLSDSSGSNYCEGRSHLGSHQLEAKNEQVLRRVQELQHLVQTSEQYLSEQEQ
GGGGGGVAMLEFDSDCDSLNSSKVSSTEGSQGGTILGPGGGIPPGHPLKHSDSLTLLAET
INHELSGITQGLNAIPESAPVSTSAPPTPATPKRKPSLCSTSSPRPQRKLNGFSQLLSDL
QALGTDFSQSESDSESVASPAQSPTTRRPQMMLLQAAGSSSGSGSSGLAPAKQQLSQRSS
FGLHSPDGTHFGAETKDYNLREYLQQLKEISNAASADTDVAARQLSEIYGFEVREDTFIE
TDTDLIDLRAIPPPQTPDELDSLSLMNAAPPKGFEGKAEELDSFLQQIMVAPPTQKATPA
KELTPEEIMSFIIPPPPNLEQQQVVPAVETECLYSNSVQAKREFFQSVANGNNGSIGNNG
MSGGHSPHVIEYATVERKSKFSCCPTSKKDEQPGQEELQPPPRTPTTEQLSPPPARPPKS
AELLQRYSPKKQVRIAASPVMQPQERRELCPPQLPPRGSPTLDGSQSSPTNPVSGPKKPP
LPPIACRPRPSNGVNSPNTSSPGSAPPAHYSPPIPATVRLPHLNQANGTLPLLPKKPQQL
HGEKLFIKNGHLIDGEALLAKTDVAMAGLLIKLDQVAAQCSVAQAAGGGTSIDEEKFQRA
RNELTEQTLALVTASKFLVASMSDMTLITLPEHLTSCLTAIRRITELAQDMTRHTSAPLQ
TRNIVLKVHDVASSFRELVGVEIGPIGAGQLALQAECLANVLATLLRSLRVFSP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]