dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0197814 (Drosophila sechellia 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_22:complement(46018..47297,47366..49021,49081..49519,49582..50030,50361..50645,52695..52791); ID=FBpp0197814; name=Dsec\GM16337-PA; parent=FBgn0171252,FBtr0199322; dbxref=FlyBase:FBpp0197814,FlyBase_Annotation_IDs:GM16337-PA,GB_protein:EDW49055,REFSEQ:XP_002042947,FlyMine:FBpp0197814; MD5=7c07c449466934d6de9b95a86b71b62a; length=1401; release=r1.3; species=Dsec;
Sequence length 1401
Sequence
MAHYDQRWLKLFSGCLFLLLLALQVSEAKRSNANLTACQHLRRSESRRAKSLEGSSVRVP
RCQKNGDFDAIQCQDEKAGRDCWCVDDYGVELPGSRNETRSGVVCAEPRHCAASACRMFC
PSRGVMNPPDHSQYTERTGYMCGSPCSHDLECRNLEKCCFTKGCQFNCQQPGNVTGCHQA
KALADILSINEREGRGYVPECNGPGGQFSPRQCSRNGLVCWCVDPRTGHKIKETMGAANN
VNCDGWENMISRSYARSFQMEQCDTNICAAVCEYGFKNDHNGCPTCECSEPCDGFKCSIG
SHCEVATDPLCESGSSLCASWPVCKPDLVYSNPCDVGTPLSDPATGEVMYCFEDRQGRSF
QPTAFFEPEPEALSKQGRSMSNRIMCPEQYKCTKLHRETENVCCPVPEKPNPAEEATGTH
QQTMCEYLRDFSERMEGTEEGMQLAVPSPRCTTDGDYEGRQCQLKKVRVTRAEQRKILEE
NTIRRMRMLLASAAPSVSKRSRRDLERLKLYRVDDSALKVQVAAPVMGRSAKVIDMGADR
QQGLGQLFETEFKKVASASKRQPENENELVEMEVEQCWCVDSFGTEIPRSRGFNVTEDTC
RSLREDLDCLDLTCRMGCEYGFSLDPDTRCPACQCRDPCEGVTCGSGKECRVVDVSCEGE
YCPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCEGARRCCSNGCGTQCVDP
QLKTACQHLQAIQLHQSSELGIPARQMAVAQCDPNNGKWNQVQCSPDGHCWCVDDQGKIL
PGTRVKSPATPKCQENSSFACPKTNCSLECESGYQMDSNGCPTCECRNYCNEVSCSPHEE
CQLISVECVDSPCPKMPICVPRRASICPEGNPLQQGDLDMSCGPHNEHEVCPTTHSCQLN
PVNNRGVCCSKTRDVCFESMDNGCLATGKSERNSTRYRFSPKANKCLPVVTDSEAPACQT
KNLFHNELACNSVCPVLTQCERLKLKNNLAAQRTGHSSVWFQPRCDPVTGHWSPVQCLGK
QPQPMDRHTEIVSRAFASEPVASAGEEAPGVCWCADKKGAPLKGTLTRESEPICNSRQAR
NRKAFDSGDPLMEQLIAQLTQLNDVASEDLDFDEVEARVLPATASAAESSVTETVLELAN
SLLDSQLSVEQATLKPMELKTTRCRALANTAPFPVSCDEAGAFRPLQCNGRSCWCVDAAG
NQLQSTHVFGAGDRRCSHVPIESVAIELHLTNSSGQSVRNAYDTIRRELQQLLGGESVEN
LRVQENFDGSAIVRFELHNEAKVDLAFAIEAAISAGDFRLAGGHFRPDLTRSHFVHRSAH
VPVAQAATAQDESIQLVLFIMATSSAFLVSIFVVYVMLKRNRNLKSANPYLKGEGGDKPV
DYSAPIFVLAADMDSKKGFAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]