dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0207274 (Drosophila sechellia 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_0:join(10902990..10903001,10903059..10903379,10903437..10903574,10903632..10903682); ID=FBpp0207274; name=Dsec\GM25797-PA; parent=FBgn0180653,FBtr0208782; dbxref=FlyBase:FBpp0207274,FlyBase_Annotation_IDs:GM25797-PA,GB_protein:EDW42099,REFSEQ:XP_002031113; MD5=2b1341016a2bde0a57668d7ba0e1b302; length=173; release=r1.3; species=Dsec;
Sequence length 173
Sequence
MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFC
PNGNPPCYKSKDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]