dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSETEP00000000053 (Echinops telfairi 69)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:TENREC:GeneScaffold_8428:173019:331544:-1 gene:ENSETEG00000000064 transcript:ENSETET00000000065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1555
Sequence
MSVRLPQSIDRLTSLSSLGDSALERKSPSHHRQHSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPXXXXXXXXXXXXXXXXXVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPAPAGAPRVTAVIPPPPPPPPLPPPQRITGPKPLQXXXXXXXXXX
XXXXXXXXXEKELQRICEVYSRNPDSLLEEQIEGTRRRVAQLQLKIQQETGGLVXXXXXX
XXXXXXXXXXRLSLDSQEGDSGLDSGTDRFSSLSESLMNRNSVLSDPGLDSPRTSPVTMA
RMTPHHKRQGLEVPVPLTSEQGVDQSSKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLRVKIP
EMLQAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPMDFALNTYMSHAGIRLREARPSNPAEKAQ
AAPDKDKWLPFFPKTKKSSNSKKDKDALEDKKRNPILKYIGKPKNSSQSTFHIPLSPVEV
KPGNVRNIIQHFENSQQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKGENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKLGRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLFVTEASHLRTLRVLDLIFYQRMKKESLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPVITEISDFMLARFDGPAREELQQVAAEFCSNQSIALELIKTKQRKEGRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIRHTEGGTSEHEKLCRARDQCREILKHV
NEAVKQTENRHRLEGYQKRLDATSLERASNPLAVEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAADSKQTFSPVLKLNALLVRSVATDKRAF
FIICTSELGPPQIYELVAVTSSDKNTWMELLDEAVRNATRHPGAAPVPIQPPPAAHPRRV
PGRVGLDESEVFHRRSSEPEPEELPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENLRRLILCSLQPSPTTGPP
ASAEPEDDLTPTPSVISITSHPWDPGSPGQAPSVGEGGTPQYPGLEGDQPEPEDMVPCSL
EDLPPRTRNSGIWESPELDEDPAEEASHAEAAGGYKVVRKAEVAGSKVGPALPESGQSEP
EPPDVEGGAKAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMELAHRELLKSLGGESSGGTTPVG
SFHAEAVRWTDSSLSPSAKEPLVSDSRDSHELRLCPEDGANSPLEDRATATAPGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]