dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSEEUP00000002835 (Erinaceus europaeus 69)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4126:2473:69821:1 gene:ENSEEUG00000003014 transcript:ENSEEUT00000003088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 2199
Sequence
GDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMHPTSVHG
VEDMIRLGDLNEAGILRNLLIRYRDHLIYXXXXXXXXXXXXXQLLSIYSSEHIRQYTNKK
IGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIE
QQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGARIEQYLLEKSRVCRQA
PDERNYHVFYCMLEGMSEDQKKKLGLGQATDYNYLAMGNCVTCEGREDSQEYASICSAMK
VLLFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDL
MNCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQEV
KSSRRSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVHHVFKLEQEEYDLESIDWLH
IEFTDNQDALDMIANKPMNIISLIDEESKFPRGTDSTMLNKLNSQHKPNSNYIPPKNNYD
TQFGINHFAGIVYYESKGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFDRHLCVRQLRYSGMMETIR
IRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQEDLQGTCQRMAEAVLGAHDDWQIGKTKI
FLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRTRGRIILFQARCRVFLVRRAFRHRLWAVLTVQAY
ARGMIARRLHRRLQAEYLRRLEVEKMRLAEEEKLRKEMSAKKAKEEAERKHQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLGKTYRREL
QALQGEAEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEELTKRLHDGESTVRGNSMREDRP
TSNEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKF
VKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGT
TKTLLADSATTAHELCSALADKISLKDRFGFSLYIALFDKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDL
AELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRR
TDVQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVL
LELSFPEIMAVSSSRECCVSLLLGCSDAGGTSLMSAGPCSPCWSCRGAKLTAPSFTLATI
KGYEYTFTSSNSEDIRDLVVTFLEGLRKRSKYVVPLQDNPNPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALVTMTPDQRQDMV
RLLQLRPPELEARGKPYTLEEFPYDYFSPPPKHTLSRVMVSKARGKDRLWSHTREPLKQA
LLKKILGSEELSQEACMAFVDVLKYMGDYPSKRMRSINELTDQIFEGALKAEPLKDEVYV
QILKQLTDNHIRYSEERGWELLWLCTGLFPPSNVLLPHVQRFLQSRKHCPLALDCLQRLQ
RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFEVESSTKAKDFCQNIAARL
LLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMK
KLWTTTVPGKDPMADSIFHYYQELKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSI
PKLLRELVPQDLIGQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFE
VKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVR
GSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGTRSSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]