dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSEEUP00000003474 (Erinaceus europaeus 69)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_684:4579:32062:1 gene:ENSEEUG00000003796 transcript:ENSEEUT00000003810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 971
Sequence
NLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMIPNQNNWLRTNWVPRD
GARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQENQFLKIDTIAADE
SFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPTMVRNLA
AFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERQDA
CVACELGFYKSAPGDQLCAHCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQVVVIRQEHAG
QTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQV
RARTSAGCGRFSQAMEVETGKSRPHYDTRTIVWICLTLITGLVVLLVLLICKKRHCGYSK
AFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKIPEPQFYAEPHNYEEPGRAGCSVTREIEA
SRIHIEKIIGSGESGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRQDFLSEASIMGQFD
HPNVIRLEGVVTRGPXXXXXXXXXXXGSLDAFLRTHDGQFTIMQLVGMLRGVGAGMRYLS
DLGYIHRDLAARNVLVDGNMVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAF
RTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQLML
DCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSRCPPPAFARSCFDLRGGGGGGLT
VGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQ
LTSTQGPRRHL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]