dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386041682|ref|YP_005960636.1| (Paenibacillus polymyxa M1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RNA polymerase sigma-F factor Stage II sporulation protein AC; Sporulation sigma factor [Paenibacillus polymyxa M1]
Sequence length 251
Sequence
MEAGGKKTSHSYLEDTEVKRLIALSQSGDNDARETLVNSNIRLVWSVVQRFMNRGYEPDD
LFQIGCIGLLKSVDKFDLSYEVKFSTYAVPMIIGEIQRFLRDDGTLKVSRSLKETANKVR
KMKDELSKRLNRLPTVKEVADELGVTPEDVVFAQEANKPPTSIHETVFENDGDPITLMDQ
IADESQERWFDKLALNEAIDGLSERERLIVYLRYYRDQTQSEVASRLGISQVQVSRLEKK
ILQLIRDQIAQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]