dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSFCAP00000000224 (Felis catus 69)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:CAT:GeneScaffold_1727:2620:34879:-1 gene:ENSFCAG00000000243 transcript:ENSFCAT00000000243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 468
Sequence
MGSRCLPLLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXIDECETGLAKCKKKSYCRNEIGSYYCSCVPNSVFNFVAGFLNDYKECYEAT
GEEIQVSRDIQEILMNNGSKNHIAKVATQVLQDMELIVWTEASAFPGKYENSTLGIVYET
KRCNDTSEKTLLEAGNNTMDINCTDAFKGTIGDRSAVALSLINLLGILPIXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVLCSIIAGVLHYLYLASFTWMLLEGLQLFLTVRNLKVA
NYIITRKFKKFMYPFGYGVLALIVAVSTGVGHSSYGIHINCWLKHDKAFIWSFMGPVAVI
ILINLVFYFQILWILRSKLSSLNKEVSTIQDTRVMTFKAIAQLFILGCSWGLGYFMVEEF
GKVIGSVIAYTFTIINVLQGVLLFVVHCLLNRQVRLIVLFITSVPPSY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]