dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|327398563|ref|YP_004339432.1| (Hippea maritima DSM 10411)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment proteinase inhibitor I2 Kunitz metazoa [Hippea maritima DSM 10411]
Sequence length 573
Sequence
MTEHILKKITLLSILFLLIVNIPAYADMGRIVAYGAKVQENSQKAIIFYNLNEEVLILGT
DLQSGSSSHILRFIPFPSKPRVQLAPKDSFKNIIKVVKKHNLQFIIQYKGVTPTTKSVEI
KLNKKIGAHDLTVIKINSTEHLREWINDFFKSKGLPVKNSYPEVEMVVNSYLNKGINYFA
FDLVKVNKKQRFVQPIEYRFHSKKLYYPLITSNTFGGSGIIDLILISPRTVCNPLESLYE
GCLGVKYLRATTSDSITIDEFNRILPDAKNFFKNKSIFIQMLSYGGSYKFKNDIFVDITN
KYKKAIGYTSNNDSSVYHSFPWEDAVGNKPPVKKPAIYLYPKTKLNINILLNIDGKITKT
VPPYSHIWKITAYPSGNISGGYDYLMYEAQLNSLTLPKSGWVVEYQNLKKWFDTYLFKIG
LNKKEKLQFEEYWLKELPKAKYYEIKLLSGDFLNKHMNIEIKPKPDTFLRFIFYFKPLSK
KIILSEQKIVTPKRVGFTAVEWGGILDKRKNKRCFLYYDRGPCEALFWRYYYNKQENICK
PFIWGGCGGSVPFKTKEECSKACISKLLVKGGN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]