dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|327398859|ref|YP_004339728.1| (Hippea maritima DSM 10411)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment diguanylate cyclase [Hippea maritima DSM 10411]
Sequence length 481
Sequence
MLRKPKSGKTHCSVYIENLSTAIIHLLIALKANDEAIDSQIDKFKEQVKKIKFEENPSKV
IALRDSIADFVIKYDEYIHQKRDEFNKLLLSNISILITLAKSSEADTRWKNSLDEVKELL
KNKIDIEQLKKTKDILFKLGTATKDSKDIVYRDIVNILFELLDLETDSPDAKPYLEKVQK
LQTKLSSSPYRLDEKEIRDEIKSIVEEKERLEEEYIESLQKKLDKALKALIYTITTFTTS
SNNYVNTFEGHIEEINNTIKNGNVDVDELSKRLIGIAIKIKDTTLNMKNELEEYSKKIDE
AKKTIEELKEKLKKAEENLIIDPLTGVYNRRGLLHFLKIEIARAKRYKQPMSIIMADLDH
FSRVNNTYGHLAGDIVLKGFCKTVKSLIRATDIAARYGGEEFIIILPNTDIDSAYEVAEK
IRNAISKLKFKYKDETFSITSSFGVSQYKDDETIEKLIKRADAALYKAKEKRNITVKESQ
I

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]