dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|317054789|ref|YP_004103256.1| (Ruminococcus albus 7)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Rumal_0059 [Ruminococcus albus 7]
Sequence length 96
Sequence
MTESVIQVGSLVWALAGREKGSCFVAVGVDGGFVYLADGRHRKVGNPKKKNIKHISPADA
QVYTGDLTDKKLRRLIFRYLTHTDRQQTRPLSGEVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]