dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|320100231|ref|YP_004175823.1| (Desulfurococcus mucosus DSM 2162)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribose-5-phosphate isomerase [Desulfurococcus mucosus DSM 2162]
Sequence length 150
Sequence
MRVAVGSDDTYSVAGFIAEYLRRKGFEVKLVGALATGKPYPWPDVGFEVGSMVARGEVDY
GVVICYTGTGVSIAANKVKGVRAALVTDARNAEGARKWNDANVLALSARLTSEELAKEII
DAFFAVREVDPSEAENIRKLKAVDTLGDTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]