dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|307155026|ref|YP_003890410.1| (Cyanothece sp. PCC 7822)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Cyan7822_5254 [Cyanothece sp. PCC 7822]
Sequence length 133
Sequence
MSHSSPNPLNDYGEEFEQDLAKAEQALEKLKQRYALILEQSQRQAELHEQRSLSEQAWQN
HPTPELEVELRQIEAQIQELQLTLESALLSSDDLKRLFWQGLRSGLLSELFWQIVRFGGI
GIIIGWILKSCSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]