dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSGACP00000001225 (Gasterosteus aculeatus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:BROADS1:scaffold_323:7460:9494:1 gene:ENSGACG00000000948 transcript:ENSGACT00000001226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 291
Sequence
SLEPTDPADRVAMPGLSGLVLLGDPPQTRCRDYRPGPHVELGEGVTGSRAGGGAAGPCED
RTCAPRTRGCRAGTADACGCCPECANLEGQSCDPGDRAGFYGTCGTGMRCEVDPRSTCVC
EEQKVLCATDGVTYMNVCQFREATFSRPELKTRGRGPCRTVPVIKVPPLSQVNGTGRSLV
FLCEVFAFPMALVEWRKEGRDVVLPGDDPHISVQSRGGPLKFEVSSWLQIEEAALEDSGT
YRCVARNNVGSVSASAVLGVLGEEELSSYLANSVSEMEQLMDATDYEHNSY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]