dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Selmo1|445374|estExt_fgenesh2_pg.C_560060 (Selaginella moellendorffii )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 484
Sequence
MADASNKKRGALRQITKDDRADDDEEDASPSEQGTFARASDEVLATRKIVKVRRSSSTAA
APSGPNLFANIQLVAPSTAPPVVSSTPAPAPVMDSPVKDPGENAKDGGKNANGNGNAKEE
EEKQAKEEVAPNENGEEEGGNPGKAPVAAALPKSFDQVSSSANAFGSFGTAFSTSSFSFS
TTGSSFSFGSSPAMGFGFFGSSTTTTTTATPAEGGKFPLFGQAPPSSGDTAAPPSSSGGG
GGGGGGHPTVSLQEVPVETGEENEKAAFSGDGILYEFVDKSWKERGKGELKLNLSEDLKK
ARLVMRSRGNLKLLLNASLFPDMRMSKMDGRSVTFACVNSAAAAASAAKDGKAVLTTYAV
KLRDAAGIPEFLGLVEAHKGIRPAAEVAEAAEEAEEVAAVEQKADDQSGSEDAQRNGGEE
QAPKEEQTNRKNKVIATMSTMSATTLLSLPSVIPALVVGLALELERDPAHRQGGRDYTTC
ELAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]