dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSPANP00000013914 (Papio anubis 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection chromosome:PapAnu2.0:20:11101456:11148457:-1 gene:ENSPANG00000015185 transcript:ENSPANT00000026892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 966
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDVYRERDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSFNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESTLPSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQMMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSSEDVASQSNKENGKQIH
MPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFS
ICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFGKYSF
LFKDLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]