dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Capca1|142796|e_gw1.429.17.1 (Capitella sp. I )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 481
Sequence
MIIAVGLIVLLASAHGDVPADGSLRLTGGAMETTGNVMVFYQGKWGIVCDDGWSLRAADV
VCRSLGYLRALGHTDQAYFGTPNEDVFLDNVRCRGDESSLLECDRNPWHDHDCEKSEAAG
VFCAPLPGSLSSPLRVNVSNSTPRITSPHEQHTPTQGPETNSIRMPIRLRGGRNEDEGRV
EVRVQGHWGAICGDHWTLLEATVVCKQVGKGHARSAVMSSVFGGEHLAKVLSGIDCMGEE
DSLDECSHARRSHDIACPEQDFIAGVVCTHELPDLVPNATLLESSTYLQDKQMYYLTCAM
EENCASASAYEIKKTVRDWHIHQRRLMRFSSSTWNFGTADFRPESNKADWEWHLCHMHFH
SMEVFAHYDLLDLQHNKVAEGHKASFCLEDVQCLPGKQKKFACKGYGDQGISVGCADDYL
HDIDCQWIDITDLKPGTYIFRVHINPNNHVAELSYSNNAVHCDLSYTGLSVTVTNCENGP
I

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]