dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000000904 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6776:65047:77554:-1 gene:ENSDORG00000000963 transcript:ENSDORT00000000963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 365
Sequence
QKLMSFADVAVNFTWKEWQDLDPGQRNLYREVMLETYSNLISLXXXXXXXXXXXXXXXXX
XXXXXXXXXXGGKRSLAVRAWVFSVNLVRCVCNICGKSYICKAYLTRHQRTGEKPYECNM
FGKSFTKSKLTVHQRTHTGEKPYECNVCGKSFIQKSKLTVHQRTHTKKKPFECNICGKSF
ICKAYKTHLTVHQRTHTKEKPFECNICGKSFTQKSNLTLHQRTHTGEKPYECNICGKSFS
WKAYLTLHQRTHTGEKPYECNKCGKSFTQKSILTRHQRTHTREKPYECNMCRKSFTWKSN
LNVHQNHTGKKPYECHKCKIFHPEADLTVHQRAHTGENFYECKMCGKSFTKKSNLNLHQR
THNRE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]