dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000004108 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:dipOrd1:scaffold_1436:11587:65460:-1 gene:ENSDORG00000004394 transcript:ENSDORT00000004395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1153
Sequence
MSSTATVNIDISDVNDNSPLFTPANYTAVIENKPVGTSILQLVVTDRDSFHNGPPFSFSI
LSGNEEEEFVLDAHGVLRSAVVFQHTESPEYVLCVQAKDSGKPQQVSHSYVRVRVIEEST
HKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDVYDVLTFALKSEQKSLFKVNSHDGKII
ALGGLDSGKYVLNVSVSDGRFQVPIDVIVHVEQLGHEMLQNTVTIRFENVSPEDFVGLHM
HGFRRTLRNAVLTQKQDNLHIISIQPVAGTNQLDMLFAVEMHNGEFYKPAYLIQKLSNAR
RHLENVMRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCT
CNGGVCSGSNDPCVEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFGDSYIK
YRLSEDSKEEDFKLALRLTLQSNGIIMYIQANPCIILKIVDGRLWFQLDCGSGPGILGIS
GRAVNDGSWHSVFLELNRNATSLSLDDSYVERRRAPLYFQTLSADSAIYFGALVQPDHVR
GLVDARGAQVLGGFQGCLDSVVLNSHELPLQNKRSSFAEVVGLTELKLGCVLYPEACQRG
PCQHGGSCTSLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICSCKA
GLTGVMCEEDVDECEREECENGGSCVNVFGSFVCNCTPGFVGQSCGLRPVVVPNIQAGHA
YVGKEELIGIAVVLFVIFVLVVLFVVFRKKVFRKNYSRNNITLVQDPATAALLHKSNGGP
FRALRAGDARNLYQEVGPPVPVRPMAYTPCFQSDSRGTLDKAADGLGPEHEMTFHPEPRI
LARRGVVCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGVDDSGDVSCFAGSNKGSNSE
VQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWMPGA
RLSDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPL
PEDFPDQYEVLAPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNETDLVGTSAGCDFS
TLAVSMNQGTEAPGPKDISLSLHNSRGTSSSDVSANCGFGDSEVAMSDYESVGELSLASL
HVPFVETQHQTQV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]