dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000008099 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:dipOrd1:GeneScaffold_238:18576:81900:-1 gene:ENSDORG00000008629 transcript:ENSDORT00000008629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 873
Sequence
MARYSVLYFILLSTLIDRDQACFCDHYPWTPWSSCSKTCNSGTQSRQRQIVMDSYYWDNS
CDQICTKQETRACNWQMCPINCLLGDYGPWSDCDPCVGKQFKIRSVLRPSQFGGQPCTEP
LSTFQPCIPSKLCRIEEADCKNKFRCDSGRCIPNRLECNGENDCGDNSDEKDCGRTKAVC
PRQYTPIPSAQLMGAGFHFLAGEPRGEVLDNSFTGGMCKTVKSSRASNPYRVPANLENVN
FEVKTEEDDLETDFYKDLINFGKNENQNKILSASQKGSSGVPFLFSKKKSKSINQNWAFK
QAIQASHKKDSSFIRVHKVIKVLNFTMQATNLQLSNVFLKALNQLPLEYNSAMYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEETQNCVRIETKKRSFFGKKKKVEHRC
TTNRLSEKHEGSILQAAEKAISLVQGGRSEYAAALAWEKGNSGPEEKVFSEWLESVKENP
AVVDFELAPIMDLVRNIPCAVTKRNNLRKAFQEYAAKFDPCQCAPCPNNGRPMLSGTECV
CVCQSGTYGENCEERSPDFKSSAVDGNWGCWSSWSACNAAYKRSRTRECNNPAPQQGGRR
CEGEERQEEHCTFSIMENIGQPCISDEEEMKEVDLPEIETDSGCPQPMLPENXXXXNEKK
LYSIGEEIEIACLTGFKAAGYQYFTCLPDRTWRRGDVECQRTECLKPIFQDVLTITPFQR
IYRLGESIELSCPKGFTVAGPSRYTCQGDSWTPPIPNSLTCEEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXHYSEDLCVFDLGSNHYFTSHCTFLAKRCLNNEQLHFLHIGSCQDGP
QLEWGLERMKLAFNSTKKELCGFDTCYDWEKCS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]