dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000009265 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5066:58683:89036:-1 gene:ENSDORG00000009857 transcript:ENSDORT00000009857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 851
Sequence
MKKWANLDSRESEDTPQENSYPDPPNGDPNCKSPPAKPHISTAKSHTRLSGKGESGEALL
MDCSYKEGKLNSCPTITVSSAATILRPGDGPACITQSSQDPVPTSVEKPLKLYDRRSIFD
AVAQSNCQELESLLPFLQKSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTISLLLDI
AQQTGSLDEFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAANGDFFKKT
KGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTT
DNTKFVTSMYNEILILGAKLHPTLKLEELTNKKGLTPLTLAASSGKIGXXXXXXXXXXXV
LAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPYEMKNT
VGDYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSIKTLFVDSYSEMLFFVQSLFMLASVV
LYFCHHKEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFL
FGFSTAVVTLIEDGKNDSVLAEPTLQSRRGPCKVQPPDNYNSLYFTCLELFKFTIGMGDL
EFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILD
TEKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDEVNWTTWNTNVGIINEDPGNCE
GVKRTLSFSLRSGRVSGRNWKNFALVPLLRDVNTRERHPAQPEEVHLKHFTGSLKPEDAE
VSKDSVAPGEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]