dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000011238 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2896:35754:54967:-1 gene:ENSDORG00000011955 transcript:ENSDORT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 497
Sequence
MAGSRRKRPQARSRPFFYALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAIPSSDQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGA
DGLAIWYTENQGLEGPVFGSADMWNGVGIFFDSFDNDGKKNNPAIVIVGNNGQIHYDHQN
DGASQALASCQRDFRNKPYPVRAKIIYYQKALTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQEL
DKKKEEFQKGHPDLQGQPADDIFESVGDRELRQIFEGQNRIHLEIKQLNRQLDMILDEQR
RYVSSLTEEISKRGAGVPGQHGQISQQELDTVVKTQQEIMRQVNEMKNSMSETVRLVSGI
QHPGAAGVYESTQHFMDIKEHLHVVKRDIDSLAQRSLPSNEKPKCPELPPFPSCLSTVHF
VIFVVVQTVLFIGYIMY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]