dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000012445 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5527:1353:27465:1 gene:ENSDORG00000013236 transcript:ENSDORT00000013236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 711
Sequence
INECVESPDPCGPHSICSNLLGRYTCSCVSGFSSPTGNNWAPGKPGTFSCADIDECVASR
ICPEHAHCTNTMGSYRCICQAGFIARGSTCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTDACDRCPANATCTNTPGGHFCTCHAGFTPSSGQQNFTD
QEVQCTDIDECSQDPELCGPNSVCANALGSYRCGCRVGFRANPGGSQAHGNFSCEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQVESFS
SVLQESPMWRNLSQPEVSALASVLLASVESSTLASLLTLSANNSQTIQTEYLDIESRIIN
EECNRDMSIQLKAKGDGIKIGCSTIEESGPTGPAGVAFVSFASLESVLDTRFFGDPSVGG
AGAKVTLRMSSRVVGAIVTGEKKAGLADPVIYTXXXXXPKQKSERPICVTWSTDTEEGRW
TPAGCVILEASERRTVCSCHQMANLAIIMASGELTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGCAIIAGVLHYLFLAAFSW
MLVEAVMLFLTVRNLKVVNYFSSRDVRMLYLCAFGYGFPGLVVAVSAGMQPQGYGMHNRC
WLNTETGFIWSFLGPVCVIITINTVLLTGTMWILRQKLSSVNAEVSTLKDT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]