dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000012574 (Dipodomys ordii 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2755:24232:48263:1 gene:ENSDORG00000013375 transcript:ENSDORT00000013374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 992
Sequence
MEERQALVASRDGDVATLERLLEAGALGPGITDALGAGLVHHATRAGHLDCVKFLVERAK
LPSNQQAHNGATPVHDAAATGNLAELRWLVRDGGCGLQDQDASGVSPLHLAARFGHPTVV
EWLLREGHAATLETQEGALPLHHAAVSGDLTCLKLLTVAHSSGVNQRTRSGASPLYLACQ
EGHLHLAQFLVKDCGADVRLRALDGMSALHAAAARGHYSLVVWLATFTDISLTARDNEGA
TALHFAARGGHTPILDRLLLLGAPIMRDSWGGTPLHDAAENGQMECCQTLLSHRVDPSLR
DEDGYTAADLAEYHGHQDCAQYLRGMAQPVPILMTPPPPPFPPPPLSAARLSVEDGGRGG
SQLRSPPPVTLSPAWPGQPGPREPPASTASPGATSTPATAEGAEMAAGEAPEGLAALQLD
VLPSGDLDGLVPTQDELGRPIPEWKRQVMVRKLQARLGTGPLLDPEAQDDSGGPGPGEPA
AWRYSQAHRAILGPFGELLTEDDLVYLEKQIADLQLRRRCEEYESELGRLAAELQALLPE
PLVRITVNSHFLPRPPGPEDEEAPAPAAEPEGPAGAEKTGPGGQPLPFWCSHIARLVRSL
SLLLTGVNGLGQSEGKAAAPGPLDTCRGVPAGPPRSDAQREIQECGVSVRTLRGNFELAP
GLPCALNLGPGEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCEEAPS
EGGAGSDLASLRKERIITLFLSHWKKSAYTPALKTAACRTLEVHRTRSRGQEAARSPEPP
PPPSEGPRLSHLWQQRGIITHLLGNWKAIMAHVPARQLRRLSRRPQGPLSPEQFLPHVDG
APVPYGSLSLDLFMLGYFQLLECDLPAEERKMRHLLCFEVFEHLGAHGWEAVRTFHKAVT
DEVASGRRAWTDGFEDIKARFFGTSQGPSWDMEPGRKLGLSPLRPLVPEPAAPRLQSGAQ
QGSFNNEDICGYIDRSFAFWKEKEAEMFHFGE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]