dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|530781180|ref|YP_008432988.1| (Thermofilum sp. 1910b)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein N186_08185 [Thermofilum sp. 1910b]
Sequence length 652
Sequence
MARGPTEKMIAAMLVLLLVVYTQTSTVTHHVAVEVKAEPLVDWLELARSAWNYFQPGVGL
SSLGLNYASISWHYLTDWDLGCYISAIVDAEALGLVDKEGTMGSDARIRKVLNFLATRPL
HPSGVPYGVYDADTGEPGTTSPSNPSDAGRLLIALYRLKQHRPEFSNYIDYVVERNGMLK
FAGGVPNNGFYSYYYAYGYYLWGARTRQVNDALNVLSTLRSKQVVDAYGVKLPFVEITME
PILYSIFELSLPEDFFYWANLTLQAQFNRYKATGKLTAFTEGNLAVPPYYIYEWIVDIYT
GKTFTLWSPSMGHTSLTPVVFTKAAIGMHAIWENEYTSLLLNYVMKAKTPNGFYEGVDEN
GNIIYIMTDKTNSLIINAARYALQKAKPPSLVVQETLETFPGESVTLPVLVNHSLSLPVH
LNVSSGIEGLTLSLQNSSGKTPLKTNLTITVYNMIRPGSYQVIILATSPLAKPVNRTLTV
IVKPPGYTLKIKALNACGEPASNVTIVLGDFKGLTARDGTLTFRHLNGTYMLYAFLGRVQ
VADPTTITISSDTELTLKLKLYKVLIDAKTTKGTPAEGIILRAFVDDQFLSYAKTNSSGL
AVLKNIPPGNITVKAYSSDGKIELGSWSITVRGDVDVVDPEIVVPEIGKIEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]