dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

psu|LbrM33_V2.3090 (Leishmania braziliensis MHOM/BR/75/M2904 2.4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Leishmania_braziliensis | product=transcription elongation factor-like protein | location=Lbr.chr33:1218327-1219751(+) | length=474
Sequence length 474
Sequence
METYAPGDRVWVYIEGDGWWPARVLSDEEMGTRTPGLDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEASIRHASADAEANPLKSASAMVVGTRVAAGGSGAAGN
LGAVAVNRAAAKRVRDTGDGSMGTYDGGAATSRPVSGYHHLRSEELHELSRKISSAVAAQ
DVATVRAVLCRLDSVDVYLTELEDTKIGVAVGSVLSQLELKPLWPLARAMVSFWARHLPP
ETLAAIRSVQQRQLSFPPIGASAAASATQHSSPLGKQQRVSFALPGESAFTSSVSPSVTT
TAAGAGAAVSVDSGVVASPQGKTFYDNVYQLLDSPLSTMRYDDAVIEKVARKLAAEITDR
DERQLLLLRLREEELSFIRDNLLSGEWTPKKYLDQPNEVFTTKSEKARQEQRIQEKIKAI
EAADNARLNITALFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNTWIQE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]