dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CPIJ016346|conserved (Culex pipiens quinquefasciatus )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein|protein_coding|supercont3.758|99227|118525
Sequence length 169
Sequence
MAGGELFRLMAPMLRTRNHVQTFLSKARVRYGVAAETACSDDKFRCKSGRCIPKHWQCDG
ENDCSDGSDEDSEKCHNKSCPSNEVMCKTGDRCIPRAWLCDRDPDCPDGSDEKECITCDN
REKTNFTLQFREFPSSSSCKVSPGSSPSWDPVNRKHKIPSPNLAHKFIL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]