dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ISCW016329-PA (Ixodes scapularis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment netrin, putative|DS642248:1025324:1026418:1|gene:ISCW016329
Sequence length 364
Sequence
MRAARSALVSLLPLLLAAAAARTGGNVGNAYLASMFAAQTQSDPCYDDMNNPRRCIPDFV
NAAFGKEVRTSSECGTPPSRYCNTATDDKGEIVRNCQICDAGNPKRRHPASYLTDLNNPN
NVTCWMSEPFPQPLYNVSLILSLGKKYELTYISLQFCGAKPDSLAVYKSTDYGKSWQPFQ
FYSSQCRKMYGRQNRALITKANEQEPLCTDPQSTTEQLSGARIAFSTLEGRPSAYEFDSS
PVLQEWVTATDVKVVFNRLTNWTPEPLDNDTLVPREASLYYAVSDFAVGGRCKCNGHGSR
CVQNRDGQLACECKHNTAGRDCEKCKPFHFDRPWGRATAHDAHECVREYPEFIPLPVCGS
ECCQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]