dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ISCW016480-PA (Ixodes scapularis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type II transmembrane protein, putative|DS632478:52419:126253:-1|gene:ISCW016480
Sequence length 2870
Sequence
MTVSLACRRVVRDPLRGFRPWILAPPTLRQYSSLQPVPADPRQPRRSQLPILSHQCSGDR
KSRVGGGGGNGPSAAGLSSSGSESPDEDVDLEEDEDDENRSDATFTGSELALARDSTLVL
QSRRVPVIPPRNLSMGRTGGGGRAGSCTGGAQGMAQDADQDYEPTCLARTPSGSLFISDL
TKGPGSPQGKTEFRPSNIIQDETKTNPDSWQHGQHPCPVIVDDVEMSSGGEDLKSTYDRQ
HDPASFKSPAPGRPNTRFKRQATDRTSRTVASTEFEDLGSGEEPADFRRPRHTVDADADA
NFKNQLNSKREFNEEPEFQADTVIIVPDDPPATRISRMNCICKRFMAESPSGPPRSGEGD
GLKSPTVKRAKGDTAGTSTKRPRFVSADNNATNNEIPISMPEQGGEPKDMTEVDELKVLE
KNEVELEEEITGSGKATAIGSQIAVKNDVSGGSELPEQDAAEFMLANSETDNRFTGDVDV
EDNQNSLEHFAGAETDIDPLGADKEAGDSGHSKAVTSASGSTEWLEIPDPSVLPAKTLPP
SSDSFMDMSVGKRHSKVIASYGHWNVQFHQLEPALVKFNYTLPTGASVGIYGRRNSVPTH
TRYDFVEILSARDRRHRKSAKVTFFYNMEFIHFLDRGQWYISVYNDGELQQEVSFVSLVA
DVSSLPCPYDCHGHGTCNMGKCDCDPDYAGESCAYRVCPVLCSGRGQYTSGECACQPGWK
GKECQLREDECEVSDCSGHGDCLDGVCRCFPGYKGLHCEEVDCLDPDCSGHGVCVSGMCL
CRKGWKSDCSEPDSDALRCLPDCSGHGQFDLDLQRCVCDDQWTGPDCSQEKCDLDCGSHG
RCQGGECICIEGWTGAKCNEKLCDIRCVEHGQCKNGTCLCIQGWNGRHCTLEGCARSCSS
HGDCVMSDGDWQCRCNSGWDGPDCSIPMEKTCDDRIDNDHDGLTDCADSECCSHKACTNN
PLCFSSSDPLDILLRKQPPAVTASFFQRMQFLIEEDSVQSYARKDSFNNSRASVIRGQVI
SFSGSPLMGIRVGIAGDPSFGFTVTRDSGWFDLMVNGGGAVTLQFRRDPFGLHERTVMVP
WNEIVIVNRVVMNIDSAKALDHRPLACTDHDYDTMKPVVLATWKHGFQGGCPERSAVLAE
SQVVQESIAIPGTALHLVYHSSRAGGYLSTIQLQLTPETIPLTLRLIHLKISIEGILFEK
KFEADPGIKFTYAWNRRNVYRQKVYGVAIATVYVGYEYNNCPAVIWEVQATQVSGHDMSI
SEIGGWNLDIHHRYNFHEGILQKGDGTNIYLKNKPKVLLTAMGDGQQRPLHCLQCNGLAK
DQRLLAPVALASSPDGSIYVGDFNLIRQITIDGKVQTIVELSAAQVAYRYHLAVGPTDSR
LYISDPERYQILQVVSYKDISDVKNNIMVVVGNGAKCLPGDKLLCGDGRPARDAKLAYPK
GIAISMHNELYIADGTNIRMVDRHGIIHTLIGDHYHKNHWKPIPCMGTFSLTQVNLRWPT
ELGINPLDNSLHILDDHMVLRLTPDKRIKIVAGRPLHCPSASGRERSDFATDVFLEAPQS
LAFAPDGDLYIAESDSQLVNRVRVLGSDGRIARFAGAELKCSCLELNCKCFDEDHYLAST
SKLSTISSITVSPDGLLHICDQGNLRLRSVTASLPKPNEQHLYEIYSPETQQVHLFNRHG
QHTATKHILTGKTVYTFSYNVNTSFGKLSTVTDAEGNKIYILRDHSNHVKTIENTQGGKC
QLEMSRMRMLHSFVTPDNFKTVFDYHGSTGLVRSKIDSSGRSVVYGYDEYGRLTEAITPS
GQTIRLSYNLSTKGAAVTVTRDGKDPVSLLIKGFDVTTRIGLSEERITQTPDGSMLLMAE
DASSRDMETVASPVITDLSPVLGETFPVPAKLRTILSDDVSQRFEWRYYLRREGKGRQKQ
IMQVGRKMKVNGDILLAIEFDRDQYSETLYDKNQIGLLTVHYDPLGHPLSWQPTQNVTAV
TLEYDRFGRLIRWERGQLSEKYSFDIRGRLADVRYADGSGIMYKYDDGPISVPTEIILPS
GSRYILQYDVSGSLQAVITPNGHKHEIATQTSIGFYKLLYLAPGVGHPYVLHFNDRGQML
AKFFPKNKGRVVFTYTEEGRLESIMCGPERTDFYYHNSTALVKSITKNVPSLDFRVDYRH
HGSLLKEERHRYNSRSGLDGAKFRYQYDARLSSVEVEINGKTSLTTKYRYNSESGVLDQV
QQFLVHRPKLNSIFIQDEARQYSKTIGTDTYGRLVVLAITLWNKEIFSLGLQYDNRSRIK
HVHTKIGKDGSSHASNYTYTVDGFLEEVSGAQSWRFIYDINGNMKSLWEGPRQISLRHDD
GDRLIGYGDIELYLVDVRGFIVQRGEEKFKFNAMGQLVHAFELHQYEVQYVYDSQNRLIA
RKDHRGNITQFIYADPQHPKAITHMHYPKDSLTFVLIYDTLGHLIYMQQGNNKFYVACDH
LGSPVAVFSSEGGIVKEVQRNPFGKVTYDSNPEFFLPVDFQGGLRDPVTQLIHFGGRVYD
ALGVQWLTPNWESVPALLQKPYDIHLYRFHGNDPINPVRTEDRHLNDLPDWMAALGYDMR
RVLVVPQTKKAPDEDTRVGAPVPETVPVISGLSCIADIVAAEFYRFSTVPKTAVKLDNSF
QRHINSRISNLPSVLGDGILLSREGPKAVVHVVSESSPILRDVMVAIFNDTFMADLRFSL
HGQDSFFFVQPQLSKAEEDWVQLGRLGTMFNITKHVVDSGEGGSTSGGGKNQVDIRMHST
SVVLNIRYGATLHEERHRLMRHARRRAVDDAWTQELELLKNGHKGSNDWTKSEREELLVN
GLVARYFGTDVHDIEKYPELADDPSNMAFRKENSRKRRGKTRRARLKPDV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]