dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ISCW016923-PA (Ixodes scapularis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment neurogenic locus notch, putative|DS689861:77572:96507:1|gene:ISCW016923
Sequence length 433
Sequence
MAGRSEAVLLSLLLLLVPSQSRNTGLHPGSVVILNPTGAPLPTDIPVRDSSETPNVPAKD
QTGAGSTEASASSTFANVATEDSPGNVPTNLPADVPTSLPTKLATDVAKTEQYNLDKNET
GSFTSPVPESSPMSTYPPSTSKQQEIFNDQTTILSTDAVTVPPTDRSSTAAATDTSPPPE
DPKGPSCAAPDLPRWRPVPKTHRLRLSRANRRRLCGSALRARHVEERRRDTDLLVVGGTD
EDPGSTFKCYCLPGYGGDLCEFEYDECDSGPCSHGAQCEDLVAGFRCHCGPGYAGRACEI
KVDLCRPDPCPPPAQCVDRGNNYSCLCHPGYDVHLSGSEPGCSGQAAWLLNVSVHARECS
KSPQDSDTCSGGGACVLEPGQTSFSCRCCPGLRNRFCEERDGCFTRPCRNGGYCVDIAEG
LTGTMFQCLCLER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]