dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ISCW024323-PA (Ixodes scapularis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment laminin subunit beta-1, putative|DS755473:221:1510:-1|gene:ISCW024323
Sequence length 188
Sequence
GEFRQLSGRKVTREQLMMALVNLDGLYIRGSYFQPSLDVRLSNVALDTALTSYVPNAAQA
LTVEQCHCPPNYKGTSCEECAAGYYRSATGPYLGFCVPCQCNGHADTCDVVTGKCHSCQD
NTFGDHCEQCLPGYHGDATRGNHDDCLICACPIPLPSNNFADSCEVSPSGQEISCNCKKG
YYGPRCDV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]