dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000003574 (Dipodomys ordii 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:dipOrd1:scaffold_25282:2388:5981:-1 gene:ENSDORG00000003826 transcript:ENSDORT00000003826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 146
Sequence
MKTALLISLASCLLVLNDRIGRCELAKILRKEHLDGFEGYTLNEXXXXXXXXXXXXXXXX
XXNADGSYDYGIFQINSHYWCNDYKSHSENFCHMDCKDILEPNLISAMQCAKKIVSGSSG
MKNWVQWILHCSGRPLSHWMTGCKVQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]