dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000013918 (Dipodomys ordii 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3708:3541:278952:1 gene:ENSDORG00000014796 transcript:ENSDORT00000014795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 451
Sequence
MVCSALRRVICVYIGLARKASHAYRSYQHQAWGSSKPTAACAAQAASGSVVELLGKSYLQ
DDHSNLSRKVLSRVGKNLHNQQHHPLWLIKERVKEHFYKQYVGRSRTPLFSVYDNLSPVV
TTWQNFDSLLIPADHPSRKKGDNYYLNQTYMLRAHTSAHQWDLLHAGLDAFLVVGDVYRR
DQIDSQHYPVFHQLEGVRLFSKHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLEIRWVDCYFPFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGAQDRIGWAFGLGLERLAMILYDIPDIRLFWSEDERFLKQFRVSDINQKVKFQPLSKY
PAVTNDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDTFEHPKTLRTSHCYRITYRH
MERTLSQREVSSVHQAVQEAVVQLLGVEGRF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]