dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PITG_01878 (Phytophthora infestans T30-4 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PITT_01878 | Phytophthora infestans conserved hypothetical protein (translation) (1540 aa)
Sequence length 1540
Sequence
MEAPCEDDASSALPTLSASCQDINTPLAAPSNIVHAPQSPSTASADVRADATAPKQSTRS
LLTLQLDREMQKRRPDHFVIGVTCRSLGGVPSNLRSQVWQELLGVARTDRPNLDQSIRQV
EEDLDNQRVVAADAARTRGNEPRFQQPETVELVVKLLTYYCKRRSIQYKQGMNEVLAPFL
LLTEQRDGAPERTPLAEGAVFQCFYALIDKLLPHVFVDKEFRSLQCSFQLYRLLMLYHDP
ALCHYLDQHDMTPELYVTPWFMTLFARSLPPEFVFYLWDFFLLEEDPYLLHFVAYALVAA
NRAKIFEADIAMLPQVLSSLTFSSRNELEQVCADALAFSELTPKSFKRDLYSVCYGGFTD
AMVPFLDQLYACSSLQVYPEELVRNLMDRLTKAKEHTSTLAPAAPVMQEEQDALNPLLSP
AEQAPLLYASGNDADEAMALKFIVLDCRPIEEYHKSHLSLSHHIDPSIMRRPAALDGLMK
GFSCMKGCHFCFVGPSVESPAVLPRPSSNNAAMNTIVRLARVISSDKSVQEQSQKPIEAH
VAEHVATSSSLPPGPATLSRKQSPGEPGALASEIGSNGASKVHAEHESVTRLVLMFLQKG
FKYVSHLDGGFDELEKTIRCMDTFTQEQLLVTSPLPPPAVTEQVTVPPETGSSSTGGFNL
FAKMGLNRPRAPSQDDFVAEVDASMRSEASDPNSGRSTSAIVSTSASVSSTPGSKEAKKK
TKATTSSAVSTLSQRLMLLKAAARDAVSSTSSSIGLSNSNTSDEVNYVEESHSTSDDGWV
EVRLKASDTVEKNAGKTTDVELQPGPIGILFQKSRTSKIFQAVVDSVVPDSQASATGLIN
TGDLLVAINGESLEGVAFLTVIEHVIEASRPVVLRFLTPVSSQRDKAATVSDIPPLAPTL
VSVTRHSICITWDKVPVSVASPAVARYQLQFAKQSGDEFNPWLPVAMKQEGTTAEVDTTG
ITDQTNGTMVGLEPGESLVFRVRCGDGQQWGPYSLSSGSMRTLNVVTAKLQSGAVTPTSV
GREDSTTAVFLAGVCPEYVERGHFFYRVLLPLHTRRRPDFNAEKLDVVLEKGLVIRGSER
LVCPGTNQIFVRVALGNTDDNVDQDGEYEGADGELMLLRNGQREADDDADGVWAFENTPD
GAVVLERLPESAGEETGPSLQEQAKSMVQSFLSSSGISPGLGDNVNSNSAGSISSMVSTA
ASSSGSNSAPPSAHTLTAPRILQVFAASSSEVVVTWDPVSDVGVTKFQIQYVKDRLAAMW
WTVKPDVEADTLKFTVSGLQPNTPYLFRLRSGTEDNKWSPYSESSESCRTPPTDRGSANN
SSDEDERKPTSSDGKKAQQTTTQAPQSASMSTGSTILDKAVAVASRLRRRSNSSNNHQPC
DETPLSKEEDETEQLEDNTKSEASARYVNLTSWKSSSNNADKSFHFYSATKFEEQDEEAH
RQLSELGHRELVVTSSALVVLIVKASTPKGFALVEEWRPLTSLTKVESRNDLDNSLVFHF
KSQVEASAERSDQLLFAVDGAKDCAKVVEDYLATVKLEGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]